PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G138500.1.p
Common NameSb09g020440, SORBIDRAFT_09g020440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 309aa    MW: 30611.1 Da    PI: 7.147
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G138500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.42.2e-4258155198
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+k+l++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq++l+ 
  Sobic.009G138500.1.p  58 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKILNELHPYQREDAVNSLAYEADMRLRDPVYGCVGVISILQHRLRL 146
                           7**************************************************************************************** PP

                DUF260  90 lkaelallk 98 
                           +++ela++ 
  Sobic.009G138500.1.p 147 VQQELARAT 155
                           *****9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.64457158IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4258154IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MAASSASSVP VVSTGSVITV AASPPPPPPT GGGGGGGGSI SAGSTGVVVG GGAGTGSPCA  60
ACKFLRRKCQ PDCVFAPYFP PDNPQKFVHV HRVFGASNVT KILNELHPYQ REDAVNSLAY  120
EADMRLRDPV YGCVGVISIL QHRLRLVQQE LARATYELSK YQAAAAAAEA ASVGVGSHGD  180
AAAGMAAVDF IGNAVANDCT QNFINVGHST AAAASISGAG GGFMQQQDSF GASVQMLARS  240
YEGGAAARVG MNGGGGSGYG GFAYSSAMGV VGHGGIVSAG LGGQQINGGQ QFLKPSTTAG  300
DDQPTATQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.54721e-130pollen
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7955601e-137AY795560.1 Triticum aestivum AS2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441102.10.0hypothetical protein SORBIDRAFT_09g020440
SwissprotQ32SG33e-97LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLC5YXV80.0C5YXV8_SORBI; Putative uncharacterized protein Sb09g020440
STRINGSb09g020440.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.43e-54LBD family protein